SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018217 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018217
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-78
Family BAR domain 0.00084
Further Details:      
 
Domain Number 2 Region: 390-506
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.72e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.00021
Further Details:      
 
Domain Number 3 Region: 249-353
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-27
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 4 Region: 659-775
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.9e-24
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018217   Gene: ENSMMUG00000013862   Transcript: ENSMMUT00000019456
Sequence length 806
Comment pep:known chromosome:MMUL_1:1:4362428:4372188:-1 gene:ENSMMUG00000013862 transcript:ENSMMUT00000019456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVI
SECLQRFADSLQEVVNYHMILFDQAQRSVRQQLHNFVKEDVRKFKETKKQFDKVREDLEL
SLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQAKKKFEILDSMLSFM
HAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKHAAIQQRTLLQDFSY
DESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDALTVVVDD
LRLCSVKPCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWVQAVQASIASAYRESPDSCY
SERLDRTASPSTSSIDSATDPRERGVKGESVLQRVQSVAGNSQCGDCGQSDPRWASINLG
VLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNRAVNQIYEAQCEGPGSRK
PTASSPRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRAQKCPRPHSSPRVPTARRKV
RLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSGLGG
SSDGSSDVLAFGSGSVVDSVTEEEGAESEESSGEADGDAEAEAWGLADVRELHPGLLAHR
AARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCEFLLQNGADVNQRDS
RGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAANADIVTLLRLARMA
EEMREAEAAPGPPGALAGSSPTELQF
Download sequence
Identical sequences ENSMMUP00000018217 9544.ENSMMUP00000018217 ENSMMUP00000018217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]