SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018252 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018252
Domain Number 1 Region: 430-636
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-65
Family Kelch motif 0.00000544
Further Details:      
 
Domain Number 2 Region: 319-473
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-35
Family Kelch motif 0.0003
Further Details:      
 
Domain Number 3 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 2.08e-28
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018252   Gene: ENSMMUG00000013884   Transcript: ENSMMUT00000019491
Sequence length 642
Comment pep:known chromosome:MMUL_1:1:185383176:185403872:1 gene:ENSMMUG00000013884 transcript:ENSMMUT00000019491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
CGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEV
MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
AEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNN
TYLCLAVLDGVFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMQYARSG
LGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALDGKLYIVGGSDPYGQKGLK
NCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWT
LIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAG
IATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF
Download sequence
Identical sequences F6R585
ENSMMUP00000018252 ENSMMUP00000018252 NP_001252839.1.72884 9544.ENSMMUP00000018252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]