SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018266 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018266
Domain Number 1 Region: 760-990
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.5e-30
Family beta 1,4 galactosyltransferase (b4GalT1) 0.09
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018266
Domain Number - Region: 666-720
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0238
Family Cystatins 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018266   Gene: ENSMMUG00000013894   Transcript: ENSMMUT00000019506
Sequence length 996
Comment pep:known chromosome:MMUL_1:11:449100:547357:1 gene:ENSMMUG00000013894 transcript:ENSMMUT00000019506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPRAARLQLLLRPVRLLRRRFRLLLALAAVSVGLWTLYLELVASAQGGGNPLNRRYGS
WRELAKALASRNIPAVDPHLQFYHPQRPNLEDHEMDQGGSSNSSYLKWNKPVPWLSEFRG
RANLHVFEDWCGSSIQQLRRNLHFPLYPHIRTTLRKLAVSPRWTNYGLRIFGYLHPFTDG
KIQFAIAADDNAEFWLSLDDQVSGLQLLASVGKTGKEWTAPGEFGKFRSQISKPVSLSAS
HRYYFEVLHKQNEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQT
AASHVGSSNALPRDEQPPADMLRPDPRDTLYRVPLIPKSRLRHVLPNCPYKPSYLVDGLP
LQRYQGLRFVHLSFVYPNDYTRLSHMETHNRCFYQENAYYQDRFGFQEYIKIDQPEKQGP
EQPGLEESLEEAQYGEVAEETPASNDQNAGMLEGRRTPASTPEQDVTDYHLRSLRKLLAQ
PRDGLPAPLSKRNSTASFPGRTSDIPARQPEKRKQKPSLEPSRDTWPPGHPAKNPPPIRG
PRPKPAGDGPRKTLEQSQWLNQVESYIAEQRWGDRRQPPAPGRGWHREEEVVAATGPEGQ
VEGEEEGEEEEEEEDMSEVFEYVPVFDPVVNWDQTFSARNLDFQALRTDWIDLNCNTSGN
LLLPEQEALEVTRVFLKKLNQRSRGRYQLQRIVNVEKRQDQLRGGRYLLELELLEQGQRV
VRISEYVSARGWQGISPAGGEEAEARNLQGLVWDPHSRRRQVLNTRAQEPKLCWPQGFSW
NHRAVVHFVVPVKNQARWVQQFITDMDNLFQVTGDPHFNVIVTDYSSEDMDVETALKRSK
LRSYQYVKLSGNFERSAGLQAGIDLVKDPHSIIFLCDLHIHFPAGVIDAIRKHCVEGKMA
FAPMVMRLHCGATPQWPEGYWEVNGFGLLGIYKSDLDRIGGMNTKEFRDRWGGEDWELLD
RILQAGLEVERLSLRNFFHHFHSKRGMWSRRQMKML
Download sequence
Identical sequences 9544.ENSMMUP00000018266 XP_001094974.1.72884 ENSMMUP00000018266 ENSMMUP00000018266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]