SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018278 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018278
Domain Number 1 Region: 92-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-52
Family F-box associated region, FBA 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018278   Gene: ENSMMUG00000013906   Transcript: ENSMMUT00000019519
Sequence length 275
Comment pep:known chromosome:MMUL_1:19:45536869:45540650:1 gene:ENSMMUG00000013906 transcript:ENSMMUT00000019519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVREGHALGGGMEADGPASPQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPE
PEQPSEVHARQLLLEEWGPLSGGLELPPRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPA
PPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPDITV
MDWFEDSRLDACVYELHVWLLAADRRSVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPG
VRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
Download sequence
Identical sequences A0A0A0MU45 A0A2K6CPQ7
ENSPANP00000000670 9544.ENSMMUP00000018278 ENSMMUP00000018278 ENSMMUP00000018278 XP_011763126.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]