SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018281 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000018281
Domain Number - Region: 27-119
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000903
Family PWWP domain 0.002
Further Details:      
 
Domain Number - Region: 300-369
Classification Level Classification E-value
Superfamily HIV integrase-binding domain 0.00942
Family HIV integrase-binding domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018281   Gene: ENSMMUG00000013910   Transcript: ENSMMUT00000019522
Sequence length 455
Comment pep:known chromosome:MMUL_1:5:167378838:167383042:1 gene:ENSMMUG00000013910 transcript:ENSMMUT00000019522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YASQLQTGDLIFTKKKYHQGPTLDEVPDGAARSCTNKLPIFFCSTHETVLLEPRNLFPYS
EKEKYSKQIKWTGFNEDFRQKDSNPKLKISNPQTPTKPSSTSSDIEVEEDIDHEEKGSKK
DMTKVIDRTTLRAQKRKTEKQVENEDAGVVKTEITSLNLKVNPKQAKLQLHKSRLQNQRQ
TPNSECPSESGMASEEDKNNKKRSRERDKEEQKEEEKPRKIINDKITSAGIISISDYEGE
REDQEGEKFGKREKKNIRTIHRSNILIGQHKKKAASIKQQMEIVQQNKDKGKPEEEQKVS
MDSQLQRIRAYMKTSLKIGSLDGNRYIEATIATSSKSQRDYGNTKKIQQVKVGQVLMKES
TICCSNFKNVFVGEGFPVITQVLNTSFTKHSQHEEVNKNKDCSEKSTNKKVEEEVGRRAL
NRGFDAQDNSQPQHNSNETSKDKHEASTTERPTGE
Download sequence
Identical sequences ENSMMUP00000018281 9544.ENSMMUP00000018281 ENSMMUP00000018281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]