SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018329 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018329
Domain Number 1 Region: 257-467
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.6e-56
Family Reprolysin-like 0.0004
Further Details:      
 
Domain Number 2 Region: 555-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 1205-1264
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000693
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 1355-1416
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000392
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1075-1135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000837
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 6 Region: 962-1023
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 1155-1207
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 8 Region: 1019-1078
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 1656-1710
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000085
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 1304-1360
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000863
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 11 Region: 1421-1475
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 12 Region: 850-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000981
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 13 Region: 1470-1531
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018329
Domain Number - Region: 901-963
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00288
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 1597-1639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0301
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018329   Gene: ENSMMUG00000013942   Transcript: ENSMMUT00000019572
Sequence length 1911
Comment pep:known chromosome:MMUL_1:11:40301226:40510137:-1 gene:ENSMMUG00000013942 transcript:ENSMMUT00000019572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVAKWLTGLLCHLLLITRSWEVHFHPRQEALVRTLTTYEVVIPERVNEFGEVFPQSHHF
SRQKRSSEALEPMPFRTHYRVTAYGQLFQLNLTADASFLAAGYTEVHLGAPGRGTWESDA
GPSDLRHCFYRGQVNSQEDYKAVVSLCGGLTGTFKGHDGDYFLEPIMKADGNEYEDGHNK
PHLIYRQELNNSFLQTLKYCSVSESQIKETSLPFHTYRNMNEDLNVMKERVLGHPSKNVP
LKDERSQLHSRKKRLISYPRYVEIMVTADAKVVSAHGSNLQNYILTLMSIVATIYKDPSI
GSFIHIVVVKLVMIHHEEEGPVINFDGATTLNNFCSWQQTQNDVDDVHPSHHDAAILITR
EDICSSKEKCNILGLSYLGTICDPLQSCFINEEKGLISAFTIAHELGHTLGVQHDDTPRC
REMNVTQYHVMAPVLSFHMSPWSWSNCSRKYITEFLDTGYGECLLDKPDEEIYNLPSELP
GSRYDGNKQCELAFGPGSQMCPHINICMHLWCTSAEKLHKGCFTQHVPPADGTDCGPGMH
CRRGLCVNKEMETRPVNGEWGPWEPYSSCSRTCGGGIESSTRHCNRPEPRNGGNYCVGRR
MKFRSCNTDSCPKGTQDFREKQCSDFNGKHLGINGIPSNVRWLPRYSGIRTKDRCKLYCQ
VAGTNDFYLLKYMVEDGTPCENETHDICVQGRCMAAGCDHVLNSSAKIDKCGVCGGDNSS
CKTITGVFNSSHYGYNVVVKIPAGATNIDIRQYSYSGQPDDSYLALSDAEGNFLFNGNFV
LSRSKKEVNVQGTRTVIEYSGSNNSVERINSTNRQEKELILQVLCVGNLYNPDVRYSFNI
PLEEWSELFTWDPYGPWEGCTKMCQGLQRRKITCIHKSDHSVVSDQKCDQLPLPSFVTQS
CNTDCELRWHVTGKSECSTQCGQGYRTLDIHCMKYSIHKGQTVQVDDHYCGDQLKPPTRE
LCRGNCVFTRWHFSEWSQCSRSCGGGERSRESYCMNNFGHRLADNECEELSRVTRENCNE
FSCPSWAASEWSECLVTCGKGIKQRQVWCQLNEDHLSDGFCNSSTKPESLSPCELHTCAS
WQVGPWGPCTTTCGHGYQMRDVKCVNELVSAVLEDTECHEASRPSNRQNCVLTPCPFISK
LKTTSLPTALIEKMAQWRHGSWTPCSVSCGRGTQARYVSCRDALDRIADESYCAHLPQPA
EIWDCFTPCGEWQAGDWSPCSASCGYGKTTRQVLCMNYHQPIDENYCDPEVRPLMEQECS
LAACPPAHSHFPSSAVQPSYYLSTNLPLTHKLEDDENQVVLPSVRGNQWRTGPWGSCSSS
CSGGLQRRAVVCQDENGQSASYCDATSKPPELQHCGPGPCPQWNYGNWGECSQTCGGGIK
SRLVICQFPNGQILEDHNCEIVNKPPSVIQCHMHACPADVSWHQEPWTSCSASCGKGRKY
REVFCIDQFQRKLEDTNCSQVQKPPTHKACRSVRCPSWKANSWNKCSMTCGSGVQQRDIY
CRLKGVGWVVEEMCDQSTRPCSQRRCWSQDCVHHKGMERERLNCSTSCERKDSHHRTECT
DSQIGQVNEIVYNSSTMSLTSKNCRNPPCNYIVVTADSSQCANNCGFSYRQRITYCTGIP
STKKHKLHRLQPIVYQECPVVPSSQVYKCINSCLHLATWKVGKWSKCSVTCGIGIMKRQV
KCVTKHGLSSDLCLNHLKPGAQKKCYANDCKSFTTCEEIQVKNHIRKDGDYYLNIKGRII
KIHCADMHLENPKEYLTLVQGEENFSEVYGFRLKNPYQCPFNGSRREDCECDNGHLAAGY
TVFSKIRIDLTSMQIKTTDLRFSKTIFGNAVPFATAGDCYSAVRCPQGQFSINLAGTGMK
ISNTAKWLAQGSYTSVSIRRSEDGTRFFGKCGGYCGKCLPHMTTGLPIQVI
Download sequence
Identical sequences NP_001104009.1.72884 ENSMMUP00000018329 9544.ENSMMUP00000018329 ENSMMUP00000018329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]