SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018381 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018381
Domain Number 1 Region: 573-648
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 2.62e-29
Family VHP, Villin headpiece domain 0.0000342
Further Details:      
 
Domain Number 2 Region: 52-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.02e-17
Family LIM domain 0.00092
Further Details:      
 
Domain Number 3 Region: 181-243
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.03e-17
Family LIM domain 0.0028
Further Details:      
 
Domain Number 4 Region: 109-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.51e-16
Family LIM domain 0.00047
Further Details:      
 
Domain Number 5 Region: 239-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000299
Family LIM domain 0.00092
Further Details:      
 
Domain Number 6 Region: 149-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000008
Family LIM domain 0.011
Further Details:      
 
Domain Number 7 Region: 22-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000011
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018381   Gene: ENSMMUG00000013984   Transcript: ENSMMUT00000019630
Sequence length 648
Comment pep:known chromosome:MMUL_1:5:668776:811369:1 gene:ENSMMUG00000013984 transcript:ENSMMUT00000019630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSFPTVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLA
EGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPP
GDRVTFNGKECMCQKCSLPVSVGSSAHLPQGLRSCGGCGTEIKNGQALVALDKHWHLGCF
KCKSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDRCEKYITGRVLEAGEKHYHPSCALC
VRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRV
IYAKLGGEILDYRDLAALPKNKAIYDIDRPDMISYSPYISHSAGDRQSYGEGDQDDRSYK
QCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAGTVSVGTSSCLSLSQHPSPTSVFRHHYI
PYFRGGSESGRSTPSLSVLSDSKPPPSTYQQAPRHFHVPDTGVKDNIYRKPPIYRQHAAR
RSDGEDGSFDQDNRKQKSSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDLLQRMPGDSF
HSRFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMREYKIYPYDSLIVTNRIRVK
LPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF
Download sequence
Identical sequences ENSMMUP00000018381 ENSMMUP00000018381 9544.ENSMMUP00000018381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]