SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018397 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018397
Domain Number 1 Region: 518-708
Classification Level Classification E-value
Superfamily Fibronectin type III 5.16e-46
Family Fibronectin type III 0.0000543
Further Details:      
 
Domain Number 2 Region: 837-1033
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-37
Family Fibronectin type III 0.0000173
Further Details:      
 
Domain Number 3 Region: 315-409
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-24
Family I set domains 0.0055
Further Details:      
 
Domain Number 4 Region: 419-514
Classification Level Classification E-value
Superfamily Fibronectin type III 3.07e-21
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 5 Region: 139-234
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 713-806
Classification Level Classification E-value
Superfamily Fibronectin type III 2.77e-16
Family Fibronectin type III 0.0000104
Further Details:      
 
Domain Number 7 Region: 42-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000476
Family I set domains 0.0097
Further Details:      
 
Domain Number 8 Region: 259-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000396
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018397   Gene: ENSMMUG00000013999   Transcript: ENSMMUT00000019648
Sequence length 1438
Comment pep:known chromosome:MMUL_1:18:45476147:46691663:1 gene:ENSMMUG00000013999 transcript:ENSMMUT00000019648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSLGCVWVPKLAFVLFGASLLSAHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLD
CSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEAS
LGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVTGEPMPTIHWQKNQQDL
TPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQL
YFLQRPSNCLSLSFVSCLIYTCVNLLFTYPMSCRSKKYSLLGGSNLLISNVTDDDSGMYT
CVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNWMKNGD
VVIPSDYFQIVGGSNLRILGVVKSDEGFYQCVAENEAGNAQTSAQLIVPKPAIPSSSVLP
SAPRDVVPVLVSSRFVRLSWRPPAEAKGNVQTFTVFFSREGDNRERALNTTQPGSLQLTV
GNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLQAVSTSPTSILITWE
PPAYANGPVQGYRLFCTEVSTGKEQNIEVDGLSYKLEGLKKFTEYSLRFLAYNRYGPGVS
TDDITVVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRG
EMETLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQP
SSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIERLESS
SHYVISLKAFNNAGEGVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDLSTPMLPPVG
VQAVALTHDAVRVSWADNSVPKNQKTSEVRLYTVRWRTSFSASAKYKSEDTTSLSYTATG
LKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQP
PLEANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLNLDTMYYFRIQARNLKG
VGPLSDPILFRTLKVEHPDKMANDQGRHGDGGYWPVDTNLIDRSTLNEPPIGQMHPPHGS
ITPQKNSNLLVIIVVTVGVITVLAVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDLR
PPDLWIHHEEMEMKNIEKPSGTDPAGRDSPIQSCQDLTPVSHSQSETQLGSKSTSHSGQD
TEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQYPGILPSPT
CGYPHPQFTLRPVPFPTLSVDRGFGAGRSQSVSEGPTTQQPPMLPPSQPEHSNSEEAPSR
TIPTACVRPTHPLRSFANPLLPPPMSAIEPKVPYTPLLSQPGPTLPKTHVKTASLGLAGK
ARSPLLPVSVPTAPEVSEESHKPTEDSVNVYEQDDLSEQMASLEGLMKQLNAITGSAF
Download sequence
Identical sequences ENSMMUP00000018397 9544.ENSMMUP00000018397 ENSMMUP00000018397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]