SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018404 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018404
Domain Number 1 Region: 142-271
Classification Level Classification E-value
Superfamily PX domain 5.76e-32
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 311-503
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000691
Family IMD domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018404   Gene: ENSMMUG00000014005   Transcript: ENSMMUT00000019655
Sequence length 559
Comment pep:known chromosome:MMUL_1:7:42490396:42531394:1 gene:ENSMMUG00000014005 transcript:ENSMMUT00000019655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPK
RTTSLLPINNGSKENGIHEEQDQEPQDLFAGNYATVELSLDNTQNNQKKVPAKTLISLPP
QEASNSSKHQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRS
KQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKR
RAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKM
TIKMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSE
DNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQ
RWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEV
MRFEKEKSKDFKNHVIKYLETLLYSQQQAGEQLGIRSGILLTKKLPRYSKFFSTVHEFFA
AASLWKWGFFLSAYLSYLF
Download sequence
Identical sequences 9544.ENSMMUP00000018404 ENSMMUP00000018404 ENSMMUP00000018404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]