SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018411 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018411
Domain Number 1 Region: 157-195,229-266
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000502
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 111-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000134
Family Ovomucoid domain III-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018411   Gene: ENSMMUG00000014011   Transcript: ENSMMUT00000019662
Sequence length 282
Comment pep:known chromosome:MMUL_1:5:72269381:72349820:1 gene:ENSMMUG00000014011 transcript:ENSMMUT00000019662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPSLHALLLGAAGLLLLLLPLSSSSSSDTCGPCEPAACPPLPPLGCLLGETRDACGCC
PMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVC
GSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS
CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
DDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Download sequence
Identical sequences A0A096NG64 A0A0D9QYL9 A0A2K5LN21 A0A2K5V311 F6QI33
9544.ENSMMUP00000018411 ENSMMUP00000018411 XP_001083041.1.72884 ENSMMUP00000018411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]