SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Macaca mulatta 69_1 > ENSMMUP00000018453

Domain assignment for ENSMMUP00000018453 from Macaca mulatta 69_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMMUP00000018453
Domain Number 1	Region: 4-77
Classification Level	Classification	E-value
Superfamily	SNARE fusion complex	4.94e-20
Family	SNARE fusion complex	0.000069
Further Details:

Domain Number 2	Region: 136-209
Classification Level	Classification	E-value
Superfamily	SNARE fusion complex	7.2e-20
Family	SNARE fusion complex	0.0000949
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMMUP00000018453 Gene: ENSMMUG00000014043 Transcript: ENSMMUT00000019711
Sequence length	211
Comment	pep:known chromosome:MMUL_1:7:20945662:20965718:1 gene:ENSMMUG00000014043 transcript:ENSMMUT00000019711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MDNLSSEEIQLRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGLD QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG PVTNGQPQQPMTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQ NPQIKRITDKADTNKDRIDIANARAKKLIDS
Download sequence
Identical sequences	A0A1D5QYR9 A0A2K6DU73 G7PB04 9544.ENSMMUP00000018453 NP_001248267.1.72884 NP_001269996.1.63531 XP_011756520.1.29376 XP_011756528.1.29376 XP_014997386.1.72884 XP_015307886.1.63531 ENSMMUP00000018453 ENSMMUP00000018453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]