SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018462 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018462
Domain Number 1 Region: 399-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-76
Family Protein kinases, catalytic subunit 0.0000000134
Further Details:      
 
Domain Number 2 Region: 5-145
Classification Level Classification E-value
Superfamily PH domain-like 2.29e-43
Family Pleckstrin-homology domain (PH domain) 0.0000501
Further Details:      
 
Domain Number 3 Region: 291-437
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-33
Family SH2 domain 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018462   Gene: ENSMMUG00000014047   Transcript: ENSMMUT00000019720
Sequence length 677
Comment pep:known chromosome:MMUL_1:X:13209935:13302043:1 gene:ENSMMUG00000014047 transcript:ENSMMUT00000019720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHIAVNEEKYRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESMKNYGFQPPSSSTTVAQYDSNSKKIYGSQPNFNMQYIPKEDY
PDWGQERKLKSSSSSEDVASSNQKERNVNHTTTKISWGFPESSSSEEEANLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSKKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMTKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDSDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHEASLPEKRPT
FQQLLSSIEPLREKDKP
Download sequence
Identical sequences G7Q299
9544.ENSMMUP00000018463 ENSMMUP00000018462 ENSMMUP00000018462 ENSMMUP00000018463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]