SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018500 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018500
Domain Number 1 Region: 110-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018500   Gene: ENSMMUG00000014078   Transcript: ENSMMUT00000019762
Sequence length 272
Comment pep:known chromosome:MMUL_1:5:105350426:105351244:-1 gene:ENSMMUG00000014078 transcript:ENSMMUT00000019762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAG
QGARGGAAAGAEGCRPARLLGLVHDCKRRPSRARAISRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
LPGALFSEAVLLSPGGASATLSSSGDSPSPASTWSCTNSPAPSSSASSNSTSPYSCTLSP
ASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Download sequence
Identical sequences A0A2K5UK99 A0A2K5X9V6 A0A2K6AQV2 F7CE59
ENSMMUP00000018500 NP_001180901.1.72884 XP_005555765.1.63531 XP_011747277.1.29376 XP_011852668.1.47321 ENSMMUP00000018500 9544.ENSMMUP00000018500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]