SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018504 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018504
Domain Number 1 Region: 241-425
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-53
Family Kelch motif 0.0000177
Further Details:      
 
Domain Number 2 Region: 384-523
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-38
Family Kelch motif 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018504
Domain Number - Region: 41-88
Classification Level Classification E-value
Superfamily POZ domain 0.00581
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018504   Gene: ENSMMUG00000014080   Transcript: ENSMMUT00000019766
Sequence length 544
Comment pep:known chromosome:MMUL_1:5:80113646:80172153:-1 gene:ENSMMUG00000014080 transcript:ENSMMUT00000019766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDSVNTKQARNHITKGKRQQQHQQIKNRSSISDGDGEDSFIFEANEAWKDFHGSLLRF
YENGELCDVTLKVELVARACCDYMKLHFHPSNCLAVRAFAESHNRIDLMDMADQYAYEHF
TEVVECEDFVSVSPQHLHKLLSSSDLNIENEKQVYNAAIKWLLANPQHHSKWLDETLAQV
RLPLLPVDFLMGVVAKEQIVKQNLKCRDLLDEARNYHLHLSSRAVPDFEYSIRTTPRKHT
AGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGPEMNSRRRHVGVISVEGKVYAVGGHDG
NEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGGLDDNTCFNDVERYDIE
SDQWSTVAPMNTPRGGVGSVALVNHVYAVGGNDGMASLSSVERYDPHLDKWIEVKEMGQR
RAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKI
FAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAVCSCLTSQIRDVGHGSNNV
VDCM
Download sequence
Identical sequences ENSMMUP00000018504 ENSMMUP00000018504 9544.ENSMMUP00000018504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]