SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018527 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018527
Domain Number 1 Region: 701-983
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-69
Family Tandem AAA-ATPase domain 0.0000293
Further Details:      
 
Domain Number 2 Region: 430-699
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.43e-57
Family Tandem AAA-ATPase domain 0.000039
Further Details:      
 
Domain Number 3 Region: 274-366
Classification Level Classification E-value
Superfamily Chromo domain-like 6.79e-23
Family Chromo domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 369-446
Classification Level Classification E-value
Superfamily Chromo domain-like 7.85e-20
Family Chromo domain 0.00000827
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018527
Domain Number - Region: 1255-1288
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0035
Family DNA-binding domain of telomeric protein 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018527   Gene: ENSMMUG00000014090   Transcript: ENSMMUT00000019790
Sequence length 1712
Comment pep:known chromosome:MMUL_1:6:95106230:95178425:-1 gene:ENSMMUG00000014090 transcript:ENSMMUT00000019790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHSDEESVRNSSGESSQSDDDSGSASGSGSGSSSGSSSDGSSSQSGSSDSDSGSESGS
QSESESDTSRENKVQAKPPKVDGAEFWKSSPSILAVQRSAMLRKQQQQQQQQQQQHQASS
NSGSEEDSSSSEDSDDSSSEVKRKKHRDEDWQMSGSGSPSQSGSDSESEEERDKSSCDET
ESDYEPKNKVKSRKPQNRSKSKNGKKILGQKKRQIDSSEEEEDEEDYDNDKRSSRRQATV
NVSYKEDEEMKTDSDDLLEVCGEDVPQPEEEEFETIERFMDCRIGRKGATGATTTIYAVE
ADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQE
TKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVERIIAHSNQKSAAGYPDYYCKWQGLPY
SECSWEDGALISKKFQACIDEYFSRNQSKTTPFKDCKVLKQRPRFVALKKQPSYIGGHEG
LELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVP
LSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWTHHQTKRLKFNILLTTYEILLK
DKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLH
FIMPEKFSSWEDFEEEHGKGREYGYASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEM
SALQKQYYKWILTRNYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKPPDNNEFYNKQE
ALQHLIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSI
KGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARA
HRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVIQRMDTTGKTVLHTGSAPSSST
PFNKEELSAILKFGAEELFKEPEGEEQEPQEMDIDEILKRAETHENEPGPLTVGDELLSQ
FKVANFSHMDEDDIELEPERNSKNWEEIIPEDQRRRLEEEERQKELEEIYMLPRMRNCAK
QISFNGSEGRRSRSRRYSGSDSDSISEGKRPKKRGRPRTIPRENIKGFSDAEIRRFIKSY
KKFGGPLERLDAIARDAELVDKSETDLRRLGELVHNGCIKALKDSSSGTERTGGRLGKVK
GPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDD
SNLLIGIYEYGYGSWEMIKMDPDLSLTHKILPDDPDKKPQAKQLQTRADYLIKLLSRDLA
KKEALSGAGSSKRRKARAKKNKAMKSIKVKEEIKSDSSPLPSEKSDEDDDKLSESKSDGR
ERSKKSSVSDAPVHITASGEPVPISEESEELDQKTFSICKERMRPVKAALKQLDRPEKGL
SEREQLEHTRQCLIKIGDHITECLKEYTNPEQIKQWRKNLWIFVSKFTEFDARKLHKLYK
HAIKKRQESQQNNDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHK
DRHQGDSYKKSESRKRPYSSFSNGKDHRDWDHYKQDSRYYGDREKHRKLDDHRSRDHRSN
LEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSP
LDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
Download sequence
Identical sequences ENSMMUP00000018527 XP_001097125.1.72884 ENSMMUP00000018527 9544.ENSMMUP00000018527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]