SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018534 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018534
Domain Number 1 Region: 43-108
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.23e-19
Family Interleukin 8-like chemokines 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018534   Gene: ENSMMUG00000029754   Transcript: ENSMMUT00000019798
Sequence length 114
Comment pep:known scaffold:MMUL_1:1099548049753:10394:103288:1 gene:ENSMMUG00000029754 transcript:ENSMMUT00000019798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLPSRAARVPGPSGSLCTLLALLLLLTPPGPLSPGGSVAAALRELRCSCLETTQGVQP
QMISNLQVFAIGPQCSEVEVVASLKNGTEVCLDPQAPFLKKVIQKILDGENKDN
Download sequence
Identical sequences 9544.ENSMMUP00000018534 ENSMMUP00000018534 ENSMMUP00000018534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]