SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018571 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018571
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily ASF1-like 8.11e-63
Family ASF1-like 0.000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018571   Gene: ENSMMUG00000014135   Transcript: ENSMMUT00000019837
Sequence length 200
Comment pep:known chromosome:MMUL_1:19:13807313:13823060:-1 gene:ENSMMUG00000014135 transcript:ENSMMUT00000019837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSGACNLEWKIIYVGSAESEEFDQILDSVLV
GPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPEL
RENPPMKPDFSQLQRNILASNPRVTRFHINWDNNTDRLEAIETQDPSLGCSLPLNCTPIK
GLGLPGCIPGLLPENSMDCI
Download sequence
Identical sequences ENSMMUP00000018571 ENSMMUP00000018571 9544.ENSMMUP00000018571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]