SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018593 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018593
Domain Number 1 Region: 6-70
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000523
Family Fibronectin type I module 0.017
Further Details:      
 
Domain Number 2 Region: 102-146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018593   Gene: ENSMMUG00000014150   Transcript: ENSMMUT00000019861
Sequence length 253
Comment pep:known chromosome:MMUL_1:4:131944083:131945362:1 gene:ENSMMUG00000014150 transcript:ENSMMUT00000019861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL
PGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
ISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSV
KTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIF
ESLYYRKMYGDMA
Download sequence
Identical sequences ENSMMUP00000018593 9544.ENSMMUP00000018593 ENSMMUP00000018593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]