SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018594 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018594
Domain Number 1 Region: 213-479
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-79
Family Protein kinases, catalytic subunit 0.00000000139
Further Details:      
 
Domain Number 2 Region: 103-246
Classification Level Classification E-value
Superfamily SH2 domain 1.42e-37
Family SH2 domain 0.00000877
Further Details:      
 
Domain Number 3 Region: 43-128
Classification Level Classification E-value
Superfamily SH3-domain 6.54e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018594   Gene: ENSMMUG00000014149   Transcript: ENSMMUT00000019862
Sequence length 491
Comment pep:known chromosome:MMUL_1:8:58482708:58620229:1 gene:ENSMMUG00000014149 transcript:ENSMMUT00000019862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKGKDSLNDDGVDLKTQPVPESQLLPGQRFQAKDPEEQGDIVVALYPYDGIHPDD
LSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAER
QLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITF
PCISDMIKHYQKQPDGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEV
WMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEY
MAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMC
KIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGK
IPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFY
TATEGQYQQQP
Download sequence
Identical sequences A0A1D5QVT2 A0A2K6NRF7
XP_005563398.1.63531 XP_007998871.1.81039 XP_010360844.1.97406 XP_011740603.1.29376 XP_015000871.1.72884 XP_017717141.1.44346 ENSMMUP00000018594 9544.ENSMMUP00000018594 ENSMMUP00000018594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]