SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018609 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018609
Domain Number 1 Region: 156-438
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-77
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 106-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.36e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018609   Gene: ENSMMUG00000014167   Transcript: ENSMMUT00000019881
Sequence length 439
Comment pep:known chromosome:MMUL_1:1:153702070:153921599:1 gene:ENSMMUG00000014167 transcript:ENSMMUT00000019881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGL
DSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYH
YGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVR
LDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPD
SDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLS
FEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDS
MHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIK
LEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences ENSMMUP00000018609 9544.ENSMMUP00000018609 ENSMMUP00000018609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]