SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018728 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018728
Domain Number 1 Region: 29-95
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.62e-20
Family SNARE fusion complex 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018728   Gene: ENSMMUG00000014262   Transcript: ENSMMUT00000020009
Sequence length 117
Comment pep:known chromosome:MMUL_1:11:6617011:6626128:-1 gene:ENSMMUG00000014262 transcript:ENSMMUT00000020009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPAQPPAEGTEGTAPGGGPPGPPPNLTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVSKYR
Download sequence
Identical sequences A0A2I3MSG8 A0A2K5MSX6 A0A2K5U1W9 A0A2K6A739 A0A2K6AQX8 F7BYS8
ENSMMUP00000018728 ENSMMUP00000018732 9544.ENSMMUP00000018732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]