SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018741 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018741
Domain Number 1 Region: 1332-1448
Classification Level Classification E-value
Superfamily Bromodomain 2.22e-32
Family Bromodomain 0.00048
Further Details:      
 
Domain Number 2 Region: 1172-1236
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-18
Family PHD domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018741   Gene: ENSMMUG00000014270   Transcript: ENSMMUT00000020023
Sequence length 1483
Comment pep:known chromosome:MMUL_1:3:50956251:51038047:-1 gene:ENSMMUG00000014270 transcript:ENSMMUT00000020023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQL
THKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEEC
DFEVGKEKMLKVKIVKIHPLEKVDEEATEKKSDGACDSPSSDKENSSQIAQDHQKKETAV
KEDEGRRESINDRARRSPRKLPTSLKKGERKWAPPKFLPHKYDVKLQNEDKIISNVPADS
LIRTERPPNKEIVRYFIRHNALRAGTGENAPWVVEDELVKKYSLPSKFSDFLLDPYKYMT
LNPSTKRKNTGSPDRKPSKKSKTDNSSLSSPLNPKLWCHVHLKKSLSGSPLKVKNSKNSK
SPEEHLEEMMKMMSPNKLHANFHIPKKGPPAKKPGKHSDKPLKAKGRSKGILNGQKSTGN
SKSPKKGLKTPKTKMKQMTLLDMAKGTQKMTRTPRNSGSTPRSSSKPHKHLPPAALHLIA
YYKENKDREDKRSALSCVISKTARLLSSEDRARLPEELRSLVQKRYELLEHKKRWASMSE
EQRKEYLKKKREELKKKLKEKAKERREKEMLERLEKQKRYEDQELTGKNLPPFRLVDTPE
GLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQ
TLLQDEIAEDYGELGMKLSEIPLTLHSVSELVRLCLRRCDVQEESEGSDTDDNKDSAAFE
DNEVRDEFLEKLETSEFFELTSEEKLQILTALCHRILMTYSVQDHMETRQQMSAELWKER
LAVLKEENDKKRAEKQKRKEMEAKNKENGKVENGLGKTDRKKEIVKFEPQVDTEAEDMIS
AVKSRRLLAIQAKKEREIQEREMKVKLERQAEEERIRKHKAAAEKAFQEGIAKAKLVMRR
TPIGTDRNHNRYWLFSDEVPGLFIEKGWVHDSIDYRFNHHCKDHTVSADEDYCPRSKKAN
LGKNANMNTQHGPATEVAVETTTPKQGQNLWFLCDSQKELDELLNCLHPQGIRESQLKER
LEKRYQDIIHSIHLARKPNLGLKSCDGNQELLNFLRSDLIEVATRLQKGGLGYVEETSEF
EARVISLEKLKDFGECVIALQASVIKKFLQGFMAPKQKRRKLQSEDSAKTEEVDEEKKMV
EEAKVASALEKWKTAIREAQTFSRMHVLLGMLDACIKWDMSAENARCKVCRKKGEDDKLI
LCDECNKAFHLFCLRPALYEVPDGEWQCPACQPATARRNSRGRNYTEESASEDSEDDESD
EEEEEEEEEEEEEDYEVAGLRLRPRKTIRGKHSVIPPAARSGRRPGKKPHSTRRSQPKAP
PVDDTEVDELVLQTKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVI
THPMDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMAKTEQCLVALL
RKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEPVGQSRGRRQKK
Download sequence
Identical sequences A0A2K5UR31 A0A2K6BQ37 F7ETW7
9544.ENSMMUP00000035370 ENSMMUP00000018741 NP_001248572.1.72884 XP_005549422.1.63531 XP_011765603.1.29376 ENSMMUP00000018741 ENSMMUP00000035370 ENSMMUP00000035371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]