SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018743 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018743
Domain Number 1 Region: 338-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-87
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 158-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.41e-35
Family Synaptotagmin-like (S variant) 0.00000177
Further Details:      
 
Domain Number 3 Region: 25-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 4 Region: 98-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.05e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018743   Gene: ENSMMUG00000014271   Transcript: ENSMMUT00000020025
Sequence length 673
Comment pep:known chromosome:MMUL_1:20:22314529:22683233:1 gene:ENSMMUG00000014271 transcript:ENSMMUT00000020025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
Download sequence
Identical sequences A0A2I3N8C1 A0A2K5L6M3 A0A2K6B2U4 A0A2K6TWG3 F7I4L6 H9FX30
ENSMMUP00000018743 9544.ENSMMUP00000018743 ENSCJAP00000038385 ENSCJAP00000045789 ENSMMUP00000018743 NP_001244443.1.72884 XP_003930252.1.74449 XP_011745492.1.29376 XP_011916107.1.92194 ENSCJAP00000038396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]