SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018840 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018840
Domain Number 1 Region: 1-204,301-332
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-18
Family FAD-linked reductases, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018840   Gene: ENSMMUG00000014341   Transcript: ENSMMUT00000020128
Sequence length 342
Comment pep:known chromosome:MMUL_1:9:87873975:88176164:-1 gene:ENSMMUG00000014341 transcript:ENSMMUT00000020128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLIVGAGVTGSLCAALLRRQTSRPLYLAVWDNAEDSGGRMTTASSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAHGILRPLTSPIEGMVMKEGDCNFVATQGISSIIKHYLK
ESGAEVYFRHRVTQINLRNDKWEVSKQTGPPEQFDLIVLTMPVPQILQLQGDIANLISEC
QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELIFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCILEALKNYI
Download sequence
Identical sequences F7CTL2
ENSMMUP00000018840 9544.ENSMMUP00000018840 ENSMMUP00000018840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]