SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018852 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018852
Domain Number 1 Region: 131-215
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000127
Family HLH, helix-loop-helix DNA-binding domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018852   Gene: ENSMMUG00000014350   Transcript: ENSMMUT00000020141
Sequence length 295
Comment pep:known chromosome:MMUL_1:9:109916868:109978032:1 gene:ENSMMUG00000014350 transcript:ENSMMUT00000020141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRGRPRKEARCEGAGLAPSAPPVVPPAAAAPQPPALPEEPAGAKPRCPFSDIFNTSEN
SMEKHINTFLQNVQILLEAASYLEQIEKENKKCEHGYASSFPSMPSPRLQHSKPPRRLSR
AQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAK
AHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSE
REEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences A0A0D9QYQ3 A0A2I3LMA3 A0A2K5NXT5 A0A2K5UQH1 A0A2K5ZW58 A0A2K6CE95 H9Z971
ENSMMUP00000018852 ENSPANP00000020974 NP_001247960.1.72884 XP_005566462.1.63531 XP_007962260.1.81039 XP_011713937.1.29376 XP_011822938.1.47321 XP_011898257.1.92194 9544.ENSMMUP00000018851 ENSMMUP00000018851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]