SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018938 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018938
Domain Number 1 Region: 98-398
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.04e-28
Family Cutinase-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018938   Gene: ENSMMUG00000014414   Transcript: ENSMMUT00000020230
Sequence length 425
Comment pep:known chromosome:MMUL_1:7:68711891:68822609:1 gene:ENSMMUG00000014414 transcript:ENSMMUT00000020230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCP
LLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEH
CVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYG
CTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSAL
RAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSL
MQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLS
EKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKSQCSDTEQV
EADLE
Download sequence
Identical sequences A0A096NN62 A0A0D9RX75 A0A2K5F3N8 A0A2K5ID47 A0A2K5M711 A0A2K5XRK3 A0A2K6E9J4 A0A2K6QIG8 G7MVW6 G7P9E4 H2QA16 Q4R2Y9
ENSMMUP00000018938 9544.ENSMMUP00000018938 9598.ENSPTRP00000012695 ENSPTRP00000012695 ENSGGOP00000011395 NP_001248192.1.72884 NP_001270570.1.63531 XP_003820467.1.60992 XP_005560519.1.63531 XP_007988532.1.81039 XP_008972118.1.60992 XP_008972119.1.60992 XP_008972120.1.60992 XP_010376946.1.97406 XP_011750588.1.29376 XP_011750589.1.29376 XP_011750590.1.29376 XP_011750591.1.29376 XP_011803709.1.43180 XP_011803710.1.43180 XP_011841701.1.47321 XP_011841703.1.47321 XP_011929776.1.92194 XP_011929777.1.92194 XP_012319301.1.9421 XP_015308713.1.63531 XP_016782577.1.37143 XP_016782578.1.37143 XP_016782579.1.37143 ENSGGOP00000011395 ENSPTRP00000012695 ENSPANP00000014422 ENSMMUP00000018938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]