SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018942 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018942
Domain Number 1 Region: 12-102,185-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000889
Family Extended AAA-ATPase domain 0.045
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018942
Domain Number - Region: 283-357
Classification Level Classification E-value
Superfamily NTF2-like 0.00657
Family SO0125-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018942   Gene: ENSMMUG00000014419   Transcript: ENSMMUT00000020235
Sequence length 757
Comment pep:known chromosome:MMUL_1:19:51784779:51804123:-1 gene:ENSMMUG00000014419 transcript:ENSMMUT00000020235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQR
AYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEV
TPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLK
ALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDN
VCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARET
DAHLANPLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLA
QRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFD
DRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFT
MTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSY
QYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEVGNGRGAVRLSWARVK
PSDGIHFMHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQC
VGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQ
MAQPFHREDQLGLSLLSLEQLESEETLQRIEQIAQQL
Download sequence
Identical sequences ENSMMUP00000018942 ENSMMUP00000018942 9544.ENSMMUP00000018942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]