SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019000 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019000
Domain Number 1 Region: 647-927
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-84
Family Protein kinases, catalytic subunit 0.000000000755
Further Details:      
 
Domain Number 2 Region: 60-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-71
Family Ephrin receptor ligand binding domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 357-560
Classification Level Classification E-value
Superfamily Fibronectin type III 3.55e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 943-1010
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.41e-21
Family SAM (sterile alpha motif) domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019000
Domain Number - Region: 275-354,390-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000534
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019000   Gene: ENSMMUG00000014468   Transcript: ENSMMUT00000020299
Sequence length 1015
Comment pep:known chromosome:MMUL_1:5:63722050:64083586:1 gene:ENSMMUG00000014468 transcript:ENSMMUT00000020299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGPRGAGRRRPPGGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNINETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGRRCG
YSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIG
AGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGV
VTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIAAGMKYLSDMGYVHRDLA
ARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASDVW
SYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCWQKDRNSR
PKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMGRY
TEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL
Download sequence
Identical sequences XP_005555256.1.63531 ENSMMUP00000019000 ENSMMUP00000019000 9544.ENSMMUP00000019000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]