SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019063 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019063
Domain Number 1 Region: 60-81,168-245,284-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000332
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019063
Domain Number - Region: 56-96,289-358,412-523
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0134
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019063   Gene: ENSMMUG00000014518   Transcript: ENSMMUT00000020367
Sequence length 546
Comment pep:known chromosome:MMUL_1:8:92551039:92573399:1 gene:ENSMMUG00000014518 transcript:ENSMMUT00000020367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSLVQYFGDNLGRKVKAMPLVEETSLLEDSSVT
FPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEARHLSIVDQDLEYLSEG
LEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNMEG
SMLTISFGSWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENT
YITSVSRLYRDQDDDDSQDRDISTKIEKSNFIKRNWEIRGYQRIADGSHVPFCLFAENVA
LATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGKVDPVLIVGSGLTAADAVLC
AYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYTSFP
EHHVLSFKSDMKCVLQSISGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITC
KGNPVEIDTFTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERG
GGDGIA
Download sequence
Identical sequences A0A0D9RKE2 A0A2K5UJL9 A0A2K6C0N0 F7GAU7
ENSMMUP00000019063 9544.ENSMMUP00000019063 ENSMMUP00000019063 NP_001247699.1.72884 XP_005563720.1.63531 XP_007999231.1.81039 XP_011766599.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]