SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019073 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019073
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily HRDC-like 4.36e-22
Family RNA polymerase II subunit RBP4 (RpoF) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019073   Gene: ENSMMUG00000014524   Transcript: ENSMMUT00000020377
Sequence length 146
Comment pep:known chromosome:MMUL_1:3:58765873:58790106:-1 gene:ENSMMUG00000014524 transcript:ENSMMUT00000020377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFRKDASSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYEVSLGFWQTYLNQ
DSGHRAMRVLNAVLSLHRAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTS
ILPAGPEAEQKKKTNSDVAMDEEDPA
Download sequence
Identical sequences G7MP37 G8F2P0
ENSMMUP00000019073 ENSMMUP00000019073 9544.ENSMMUP00000019073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]