SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019093 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019093
Domain Number 1 Region: 33-154
Classification Level Classification E-value
Superfamily Gamma-glutamyl cyclotransferase-like 0.000000000000569
Family Gamma-glutamyl cyclotransferase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019093   Gene: ENSMMUG00000014542   Transcript: ENSMMUT00000020398
Sequence length 222
Comment pep:known chromosome:MMUL_1:7:19345244:19348318:1 gene:ENSMMUG00000014542 transcript:ENSMMUT00000020398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQESAASNTPPASQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGY
SRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSEALKYLNVREAVLGG
YDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLL
RLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
Download sequence
Identical sequences ENSMMUP00000019093 ENSMMUP00000019093 9544.ENSMMUP00000019093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]