SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019099 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019099
Domain Number 1 Region: 55-234
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-75
Family F-box associated region, FBA 0.00000843
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019099
Domain Number - Region: 1-32
Classification Level Classification E-value
Superfamily F-box domain 0.000436
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019099   Gene: ENSMMUG00000014544   Transcript: ENSMMUT00000020405
Sequence length 237
Comment pep:known chromosome:MMUL_1:19:45358216:45366094:-1 gene:ENSMMUG00000014544 transcript:ENSMMUT00000020405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRCRQVCRGWRALVDGQALWLLILARDHSATGRALLHLARSCQSPARNARPCPLGRFCA
RRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCRKKQV
LDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPI
PQWNNNACLHVTHVFSNIKMGVRFVSFEHWGQDTQFWAGHYGARVTNSSVIVRVHLS
Download sequence
Identical sequences ENSMMUP00000019099 ENSMMUP00000019099 9544.ENSMMUP00000019099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]