SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019119 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019119
Domain Number 1 Region: 842-1119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-71
Family Protein kinases, catalytic subunit 0.00000423
Further Details:      
 
Domain Number 2 Region: 522-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-49
Family Protein kinases, catalytic subunit 0.0000768
Further Details:      
 
Domain Number 3 Region: 396-501,538-563
Classification Level Classification E-value
Superfamily SH2 domain 5.69e-19
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 4 Region: 279-386
Classification Level Classification E-value
Superfamily PH domain-like 6.02e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 141-261
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000283
Family Second domain of FERM 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019119   Gene: ENSMMUG00000014558   Transcript: ENSMMUT00000020426
Sequence length 1132
Comment pep:known chromosome:MMUL_1:15:72080798:72233230:-1 gene:ENSMMUG00000014558 transcript:ENSMMUT00000020426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPECIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSDESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGIRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNLRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences A0A2K5WBJ6 A0A2K6BRZ3 F7GT47
NP_001252830.1.72884 XP_005581848.1.63531 XP_005581849.1.63531 XP_011756866.1.29376 XP_011756867.1.29376 XP_011756868.1.29376 XP_014973249.1.72884 XP_015292699.1.63531 9544.ENSMMUP00000019119 ENSMMUP00000019119 ENSMMUP00000019119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]