SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019141 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019141
Domain Number 1 Region: 68-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.03e-35
Family SPRY domain 0.0052
Further Details:      
 
Domain Number 2 Region: 1246-1299
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000389
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019141   Gene: ENSMMUG00000014564   Transcript: ENSMMUT00000020450
Sequence length 1311
Comment pep:known chromosome:MMUL_1:2:86697345:86731721:-1 gene:ENSMMUG00000014564 transcript:ENSMMUT00000020450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKGAGMSFSRKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSDHVPPAATSRKPLN
FQNLPEHLDQLLQVDNEEEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSN
FGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTISCRFNQEEGVGDTHNSYAYDGNRVRK
WNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLS
FKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDK
ESSKWRLRGQPTVLLTLAHIFHRFAPLLRKVYLVEAVLMSFLLGIVEKGTPAQAQSVVHQ
VLDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDLGLQIHYLRLTIAILRHEKSRKF
LLSNVLFDVLRSVVFFYIKSPLRVEEAGLQELIPTTWWPHRSSREGKESTEMKEETAEER
LRRRAYERGCQRLRKRIEVVEELQVQILKLLLDNKDDNGGEASRYIFLTKFRKFLQENAS
GRGNMPVLCPPEYMVCFLHRLISALRYYWDEYKASNPHASFSEEAYIPPQVFYNGKVDYF
DLQRLGGLLSHLRKTLKDDLASKANIVIDPLELQSTTMDDLDEDEEPAPAMAQRPMQALA
VGGPLPLPRPGWLSSPTLGRANRFLSTAAVSLMTPRRPLSTSEKVKVRTLSVEQRTREDI
EGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEYA
MALRDTEDKLRRCPKRRKDIIAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIYW
LLRVCLQTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRL
AAILAKHFADTRIVGTDIRDSLMQALASYVCYPHSLRAVERIPEEQRIAMVRNLLAPYEQ
RPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKLEDANLPSLQKPCPSTLLQQHMADLLQ
QGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVS
LLRVLEMTITLVPEIFLDWTRPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGL
ESVDHYPILVAVTGILVQLLVRGPASERERATSVLLADPCFQLRSICYLLGQPEPPAPGT
ALPAPDRKRFSLQSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAH
PISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVSVEDWANTSTTSSAA
Download sequence
Identical sequences ENSMMUP00000019141 9544.ENSMMUP00000019141 ENSMMUP00000019141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]