SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019142 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019142
Domain Number 1 Region: 229-360
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-30
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 438-570
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 126-233
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-25
Family Cadherin 0.0036
Further Details:      
 
Domain Number 4 Region: 339-443
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-21
Family Cadherin 0.006
Further Details:      
 
Domain Number 5 Region: 554-663
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 28-95
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000971
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019142   Gene: ENSMMUG00000014579   Transcript: ENSMMUT00000020451
Sequence length 795
Comment pep:known chromosome:MMUL_1:6:137519061:137521710:1 gene:ENSMMUG00000014579 transcript:ENSMMUT00000020451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLGRIHPNRQVLAFILMVILSQVHLEPIRYSVLEETESGSFVAHLTKDLGLGIAELAA
RSAGVVSDDDKQRLQLDRQTGDLFLREKLDREELCGPIEPCILHFQVFLEMPVQFFQGEL
LIQDINDHSPVFPEREVLLKIPENSQPGTLFPLLIAEDLDVGSNGLQKYTISPNSHFHIL
TRNHSEGKKYPDLVQDKPLDREEQSEFSLTLVALDGGSPPRSGTVMVRILIMDINDNAPE
FVHTPYGVQVLENSPLDSPIVRVLARDVDAGNFGSVSYGLFQASDEIKQTFSINEVTGEI
LLKKKLDFEKIKSYHVEIEATDGGGLSGKGTVVIEVVDVNDNPPELIISSLTSSIPENAP
ETVVSIFRIRDRDSGENGKTICSIPDNLPFVLKPTLKNFYTLVTERPLDRETRAEYNITI
TVTDLGTPRLKTQQSITVQVSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSG
TNAQVTYLLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQGFEFRVGAADRGSPAL
SSEALVRVLVLDANDNSPFVLHPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAW
LSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPRSATATLHVL
LVDGFSQPYLPLPEAALAQAQNDSLTIYLVVALASVSSLFLLSVLLFVAVRLCRRSRAAS
VGRCSVPEGPFPGHQVGVSGTETLSQSYQYEVCLTGDSGTGEFKFLKPIFPNLLVQDTRR
EVKENPNFRNSFVFS
Download sequence
Identical sequences ENSMMUP00000019142 9544.ENSMMUP00000019142 ENSMMUP00000019142 XP_001090927.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]