SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019164 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019164
Domain Number 1 Region: 352-435
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00000776
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019164   Gene: ENSMMUG00000014601   Transcript: ENSMMUT00000020477
Sequence length 439
Comment pep:known chromosome:MMUL_1:8:130349300:130354453:1 gene:ENSMMUG00000014601 transcript:ENSMMUT00000020477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEEEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
Download sequence
Identical sequences A0A2K5MVB9 A0A2K6AZG2 B8XIA5 G7N040 G7PCT8
ENSMMUP00000019164 NP_001136345.1.72884 XP_005564119.1.63531 XP_011758346.1.29376 XP_011758347.1.29376 XP_011832670.1.47321 XP_011921024.1.92194 XP_015001416.1.72884 9544.ENSMMUP00000019164 ENSMMUP00000019164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]