SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019188 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019188
Domain Number 1 Region: 938-1083
Classification Level Classification E-value
Superfamily Bromodomain 9.55e-27
Family Bromodomain 0.00052
Further Details:      
 
Domain Number 2 Region: 269-330
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.52e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 876-933
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000117
Family PHD domain 0.0036
Further Details:      
 
Domain Number 4 Region: 124-191
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000254
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019188   Gene: ENSMMUG00000014620   Transcript: ENSMMUT00000020503
Sequence length 1127
Comment pep:known chromosome:MMUL_1:1:117385688:117502656:-1 gene:ENSMMUG00000014620 transcript:ENSMMUT00000020503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENKGGGEAESGGGGSGSAPVTAGAAGPAEQEAEPPLTAKKVEEEEEEGGRAGAEGGAA
GPDDGGVAAASSGSAQAASSPAASVGPAVPGGAVSTPAPAPASAPAPGPSAGPPPGPPAS
LLDTCAVCQQSLQSRREAEPKLLPCLHSFCLRCLPEPERQLSVPIPGGSNGDIQQVGVIR
CPVCRQECRQIDLVDNYFVKDTSEAPSSSDEKSEQVCTSCEDNASAVGFCVECGEWLCKT
CIEAHQRVKFTKDHLIRKKEDVSESVGASGQRPVFCPVHKQEQLKLFCETCDRLTCRDCQ
LLEHKEHRYQFLEEAFQNQKGAIENLLAKLLEKKNYVHFAATQVQNRIKEVNETNKRVEQ
EIKVAIFTLINEINKKGKSLLQQLENVTKERQMKLLQQQNDITGLSRQVKHVMNFTNWAI
ASGSSTALLYSKRLITFQLRHILKARCDPVPAANGAIRFHCDPTFWAKNVVNLGNLVIES
KPTPGYTPNVVVGQVPPGTNHISKTPGQINLAQLRLQHMQQQVYAQKHQQLQQMRMQQPP
APVPTTTTTTQQHPRQAAPQMLQQQPPRLISVQTMQRGNMNCGAFQAHQMRLAQNAARIP
GIPRHSSPQYSMMQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSP
SVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPS
PGPSALSPGSSGLSNSHTPVRPPSTSSTGSRGSCGSSGRTAEKTSLSFKSDQVKVKQEPG
TEDEICSFSGGVKQEKTEDGRRSACMLSSPESSLTPPLSTNLHLESELDALASLENHVKT
EPADMNESCKQSGLSSLVNGKSPIRSLMHRSARIGGDGNNKDDDPNEDWCAVCQNGGDLL
CCEKCPKVFHLTCHVPTLLSFPSGDWICTFCRDIGKPEVEYDCDNLQHSKKGKTAQGLSP
VDQRKCERLLLYLYCHELSIEFQEPVPASIPNYYKIIKKPMDLSTVKKKLQKKHSQHYQI
PDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEI
YSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK
Download sequence
Identical sequences ENSMMUP00000019188 9544.ENSMMUP00000019188 ENSMMUP00000019188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]