SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019197 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019197
Domain Number 1 Region: 94-440
Classification Level Classification E-value
Superfamily Subtilisin-like 9.95e-82
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 434-580
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.93e-43
Family Proprotein convertase P-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 11-82
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 7.65e-16
Family Prohormone convertase 1 pro-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019197   Gene: ENSMMUG00000014626   Transcript: ENSMMUT00000020512
Sequence length 619
Comment pep:known chromosome:MMUL_1:10:50555119:50809689:1 gene:ENSMMUG00000014626 transcript:ENSMMUT00000020512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFASAERPVFTNHFLVELHKGGEDEARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKR
RRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLINTGQAD
GTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAEASYDFSSNDPYPYPR
YTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMP
QLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNC
DGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLR
HSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFN
HLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIPSTGKLVLTLTTDACEGKEN
FVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHT
WGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKEEL
EEELDEAVERSLKSILSKN
Download sequence
Identical sequences ENSMMUP00000019197 ENSMMUP00000019197 9544.ENSMMUP00000019197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]