SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019213 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019213
Domain Number 1 Region: 216-489
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-83
Family Protein kinases, catalytic subunit 0.0000000766
Further Details:      
 
Domain Number 2 Region: 111-254
Classification Level Classification E-value
Superfamily SH2 domain 3.42e-40
Family SH2 domain 0.0000259
Further Details:      
 
Domain Number 3 Region: 37-120
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-22
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019213   Gene: ENSMMUG00000014635   Transcript: ENSMMUT00000020529
Sequence length 505
Comment pep:known chromosome:MMUL_1:4:147871636:147984919:1 gene:ENSMMUG00000014635 transcript:ENSMMUT00000020529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGAHCSPQSQRHGRYFVALFDYQARTAED
LSFRAGDKLQVLDTSHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGA
IRRSDAEKQLLYSKNKTGAFLIRESESQKGEFSLSVLDGGVVKHYRIRRLDEGGFFLTRR
ITFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEIDRNSIQLLKRL
GSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPRDFLREAQIMKNLRHPKLIQLYAVCTLED
PIYIITELMRHGSLQEYLQSDAGSKIHLTQQVDIAAQVASGMAYLESRNYIHRDLAARNV
LVGEHNIYKVADFGLARVFKVDNEDIYESKHEIKLPVKWTAPEAIRTNKFSIKSDVWSFG
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTF
ETLHWKLEDYFETDSSYSDANNFIR
Download sequence
Identical sequences G7MQP6
XP_001112190.1.72884 XP_014993032.1.72884 ENSMMUP00000019213 ENSMMUP00000019213 9544.ENSMMUP00000019213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]