SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019267 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019267
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019267   Gene: ENSMMUG00000014688   Transcript: ENSMMUT00000020591
Sequence length 165
Comment pep:known chromosome:MMUL_1:1:5605793:5606489:-1 gene:ENSMMUG00000014688 transcript:ENSMMUT00000020591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVFLTLHAASDTQMKLLYHFQR
PPAAPAAPAKEPKAPGAATPPALSAKATAAAAAARQPACGLWRPW
Download sequence
Identical sequences 9544.ENSMMUP00000019267 ENSMMUP00000019267 ENSMMUP00000019267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]