SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019418 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019418
Domain Number 1 Region: 172-447
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.11e-93
Family Transglutaminase core 0.000000000162
Further Details:      
 
Domain Number 2 Region: 477-653
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-61
Family Extended PAW domain 0.0000000651
Further Details:      
 
Domain Number 3 Region: 13-116
Classification Level Classification E-value
Superfamily PUG domain-like 7.72e-32
Family PUG domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019418   Gene: ENSMMUG00000014790   Transcript: ENSMMUT00000020752
Sequence length 654
Comment pep:known chromosome:MMUL_1:2:168194903:168262564:-1 gene:ENSMMUG00000014790 transcript:ENSMMUT00000020752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALGSSSGSASPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTA
FSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSNKSH
KLESSQQPAASTQLPTTPSSNPSGLNQHTRNRQGQSPDPPSASTVTPDSAILGVLQSNIQ
HVLVYENPALQEKALACIPVQELKRKSQEKLSRVRKLDKGIIMFDEDFLLLELLHWFKEE
FFHWMNNILCSKCGGQTRSRDRSLLPNDDELKWGAKKVEDHYCDACQFSNRFPRYNNPEK
LLETRCGRCGEWANCFTLCCRALGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCD
KPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHEEVIARRTKVKEALLRETINGLNKQ
RQLFLSENRRKELLQRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLQRKETS
FIPSENEKISKQLHLCYNIVKDRYVRVSNNNQTISGWENGVWKMESIFRKVETDWHMVYL
ARKEGSSFAYISWKFECGSVGLKIDSISIRTTSQTFQTGTIEWKLRSDTARVELTGDNNL
HSYADFSGATEVILEAELSRGDGDVAWQHTQLFRQSLNDHEENCLEIIIKFSDL
Download sequence
Identical sequences ENSMMUP00000019418 ENSMMUP00000019420 9544.ENSMMUP00000019420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]