SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019514 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019514
Domain Number 1 Region: 552-851
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-83
Family Protein kinases, catalytic subunit 0.000000000718
Further Details:      
 
Domain Number 2 Region: 257-463
Classification Level Classification E-value
Superfamily Fibronectin type III 2.51e-42
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 3 Region: 32-129
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-29
Family Ephrin receptor ligand binding domain 0.00011
Further Details:      
 
Domain Number 4 Region: 846-921
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.43e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 5 Region: 186-248
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000302
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019514   Gene: ENSMMUG00000014867   Transcript: ENSMMUT00000020857
Sequence length 924
Comment pep:known chromosome:MMUL_1:4:89161849:89336467:-1 gene:ENSMMUG00000014867 transcript:ENSMMUT00000020857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTRDCNSLPGDVGACIA
LVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEG
EWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECED
GYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSW
EQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAV
SITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVK
TKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNP
VIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETY
EDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEK
QRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQ
LVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTT
GGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYR
LPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPL
LDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQ
KKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences ENSMMUP00000019514 9544.ENSMMUP00000019514 ENSMMUP00000019514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]