SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019562 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019562
Domain Number 1 Region: 234-410
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 520-635
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-16
Family Second domain of FERM 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019562
Domain Number - Region: 422-513
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0258
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019562   Gene: ENSMMUG00000014907   Transcript: ENSMMUT00000020913
Sequence length 736
Comment pep:known chromosome:MMUL_1:3:125019968:125061517:1 gene:ENSMMUG00000014907 transcript:ENSMMUT00000020913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYTYTPGCPIFYCFQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETSQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLNYGCFMWQLGDADTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
Download sequence
Identical sequences A0A096NZS9 A0A1D5Q0D0 A0A2K5MTZ0 A0A2K6CH04 G7P1T9
NP_001248698.1.72884 XP_005550300.1.63531 XP_005550301.1.63531 XP_005550302.1.63531 XP_005550303.1.63531 XP_005550304.1.63531 XP_005550305.1.63531 XP_005550306.1.63531 XP_005550308.1.63531 XP_011729073.1.29376 XP_011729074.1.29376 XP_011729076.1.29376 XP_011729077.1.29376 XP_011729078.1.29376 XP_011729079.1.29376 XP_011729080.1.29376 XP_011729081.1.29376 XP_011729082.1.29376 XP_011729083.1.29376 XP_011729084.1.29376 XP_011729085.1.29376 XP_011729087.1.29376 XP_011729088.1.29376 XP_011729089.1.29376 XP_011729090.1.29376 XP_011729091.1.29376 XP_011729092.1.29376 XP_011729093.1.29376 XP_011729094.1.29376 XP_011887474.1.92194 XP_011887475.1.92194 XP_011887476.1.92194 XP_011887477.1.92194 XP_011887478.1.92194 XP_011887479.1.92194 XP_011887480.1.92194 XP_011887481.1.92194 XP_011887482.1.92194 XP_011887483.1.92194 XP_011887484.1.92194 XP_011887485.1.92194 XP_011887486.1.92194 XP_011887487.1.92194 XP_011887488.1.92194 XP_011887489.1.92194 XP_011887490.1.92194 XP_011887491.1.92194 XP_011887492.1.92194 XP_011887493.1.92194 XP_011887494.1.92194 XP_011887495.1.92194 XP_011887496.1.92194 XP_011887497.1.92194 XP_011887498.1.92194 XP_011887500.1.92194 XP_011887501.1.92194 XP_011887503.1.92194 XP_011887504.1.92194 XP_014989691.1.72884 XP_014989692.1.72884 XP_014989693.1.72884 XP_014989694.1.72884 XP_014989695.1.72884 XP_014989696.1.72884 XP_014989697.1.72884 XP_014989698.1.72884 XP_014989699.1.72884 XP_014989700.1.72884 XP_014989701.1.72884 XP_014989702.1.72884 XP_014989703.1.72884 XP_014989704.1.72884 XP_014989705.1.72884 XP_014989706.1.72884 XP_014989707.1.72884 XP_014989708.1.72884 XP_015303259.1.63531 XP_015303260.1.63531 XP_015303261.1.63531 XP_015303262.1.63531 XP_015303263.1.63531 XP_015303265.1.63531 XP_015303266.1.63531 XP_015303267.1.63531 XP_015303268.1.63531 XP_015303269.1.63531 XP_015303270.1.63531 XP_015303271.1.63531 XP_015303273.1.63531 XP_015303274.1.63531 XP_015303275.1.63531 XP_015303276.1.63531 ENSMMUP00000019562 ENSPANP00000018604 ENSMMUP00000019562 9544.ENSMMUP00000019562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]