SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019584 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019584
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.06e-68
Family Crotonase-like 0.00000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019584   Gene: ENSMMUG00000014927   Transcript: ENSMMUT00000020935
Sequence length 248
Comment pep:known chromosome:MMUL_1:19:45158022:45168632:-1 gene:ENSMMUG00000014927 transcript:ENSMMUT00000020935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKAFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDLASDILQPKGDDVARISW
YLRDIITRYQETFSVIEKCPKPVIAAIHGGCIGGGVDLITACDIRYCAQDAFFQVKEVDV
GLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGCGLVSRVFPDKEVMLDAALAL
AAEISSKSPVAVQSTKVNLLYSRNHSVAESLNYVASWNMSMLQTQDITKSVQAVTENKEL
KSVTFSKL
Download sequence
Identical sequences G7PXH6
9544.ENSMMUP00000019584 ENSMMUP00000019584 ENSMMUP00000019584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]