SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019592 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019592
Domain Number 1 Region: 1045-1261
Classification Level Classification E-value
Superfamily Kelch motif 9.29e-30
Family Kelch motif 0.02
Further Details:      
 
Domain Number 2 Region: 1322-1443
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000235
Family Kelch motif 0.013
Further Details:      
 
Domain Number 3 Region: 752-800
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000398
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 4 Region: 615-650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 704-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000326
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019592
Domain Number - Region: 1793-1843
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 14-83
Classification Level Classification E-value
Superfamily Kelch motif 0.000301
Family Kelch motif 0.046
Further Details:      
 
Domain Number - Region: 1721-1756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000399
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 1887-1922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family Laminin-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019592   Gene: ENSMMUG00000014932   Transcript: ENSMMUT00000020945
Sequence length 2385
Comment pep:known chromosome:MMUL_1:19:48658497:48701192:1 gene:ENSMMUG00000014932 transcript:ENSMMUT00000020945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVYGGNVHTHYQEEKCYEDGIFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAA
VLGGSVLLVAGGYSGRPRGDLMAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSW
CQGACQAAPPPGTPLGACPAASCLGLGRLLGDCQACLAFSSPTAPPRGPGTLGWCVHNES
CLPRPEQARCRGEQISGTVGWWGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDK
VSIVRSTTITLTPSAETDVSLVYRGFIYPMLPGGPGGPGSEDVAVWARAQRLHVLARMAR
GPDTENMEEVGRWVAHQEKETRQLQRPGSARLFPLPGRDHKYAVEIRGQLNGSAGPGHSE
LTLLWDRTGVPGGSEISFFFLEPYRSSACTSYSSCLGCLADQGCGWCLTSASCHLRQGGA
HCRDDRAGGSLLVLVPTLCPLCEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGRGA
IKSPDECPPLCNQRLTCEDCLANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHS
EPRCRSCDGFLTCHECLQSHECGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGL
PVALPARWAYARCPDVDECRLGLARCHPRATCLNTPLSYECHCQRGYQGDGISHCNRTCL
EDCGHGVCSGPPDFTCVCDLGWTSDLPLPTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFC
DECQDWTWGEHCERCRPGSFGNATGSRGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEG
AHCQLCSPGYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRVGGLLPPGGGAARAGPGL
SYCVWVVSATEELQPCAPGTLCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSD
RSLIAAFCGQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQ
ECVPQDGAAGAGLCRCPQGWAGPHCRMALCPENCNAHTGAGTCNQSLGVCICAEGFGGPD
CATKLDGGQLVWETLMDSRLSADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNL
YRYSVSERRWTQMLAGAEDGGPGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVL
NLTTLQWRQEKAPQTVELPAVAGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTW
VSGAQSGTPPTGLYGHSAVYHEATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLA
PSQGAKGDCVRNVGGSSQGVWVPREQPGSWGFRELRKEMVLWAALAGTGGFLEEISPHLK
EPRPRLFHASALLGDTMVVLGGRSDPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPVEE
SVAHAVAAVGGRLYISGGFGGVALGRLLALTLPPDPCRLLSSPEACNQSGACTWCHGACL
SGDQAHRLGCGGSPCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNC
PEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTG
ETRRILSVQPTYDWTCFSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGW
QHCVWSSSLQQCLSPSYLPLRCMAGGCGRLLRGPESCSLGCAQATQCASCLRRPHCGWCA
WGGQDGGGRCMEGGLSGPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPH
GYECSCKTGYTMDNVTGLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSE
CAGVGARDHCLLCRNHTKGSHCEQCLPLFVGSAVGGGTCRPCHTFCRGNSHVCISKKEFE
MAKGEPQKYSLDPEEIENWVTEGPSEDEAMCVNCQNNSYGEKCESCLQGYFLLDGKCTKC
QCNGHADTCNEQDGTGCPCQNNTETGTCQGSSPSDRRDCYKFQCAKCRESFHGNPLGGQQ
CYRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAV
DLYVSTSFDTFVVRVAPDTGVHTVHIQASQPPPPPPPLADGGPRGAGDPGGAGASSGPGA
PAEPRVREVWPQGLITYVTVTEPSAVLVVHSVRDRLVITYPHEHHALKSSRFYLLLLGVG
DPSGPGTNGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQ
EQRRHLQEMTKMASRPFAKVTVCFPPDPTALAPAWKPAGLPPPAFRRSEPFLAPLLLTGA
GGPWGPMGGGCCPPAIPATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLG
SALVTLRHRLHEYCGGGGVAGGSGHGAGVGRKGLLSQDNLTSMSL
Download sequence
Identical sequences ENSMMUP00000019592 ENSMMUP00000019592 9544.ENSMMUP00000019592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]