SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019599 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019599
Domain Number 1 Region: 29-217,317-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.74e-46
Family Bacterial dinuclear zinc exopeptidases 0.0046
Further Details:      
 
Domain Number 2 Region: 206-308
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.09e-21
Family Bacterial exopeptidase dimerisation domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019599   Gene: ENSMMUG00000014942   Transcript: ENSMMUT00000020952
Sequence length 436
Comment pep:known chromosome:MMUL_1:4:84995692:85012840:1 gene:ENSMMUG00000014942 transcript:ENSMMUT00000020952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGVERSVEGGAYDGSSELELLKLRAAECIDKAAERLGALSRAIWSQPELAYEEHHAHR
VLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSAAPRPLHLGFLCEYDALPGI
GHACGHNLIAEVGAAAALGVRGALEGLPRPPPPVKVIVLGTPAEEDGGGKIDLIEAGAFT
NLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSAAYPWEGLNALDAAVLAYNNLSV
FRQQMKPTWRVHGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALA
SGCTVEIKSGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDKMLNGPSGSTDFGNVTFV
VPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLERIRE
DFKLKLQEEQFVNAVE
Download sequence
Identical sequences A0A2K5UGH7 F6TN77
ENSMMUP00000019599 ENSMMUP00000019599 XP_001095121.1.72884 XP_005552436.1.63531 9544.ENSMMUP00000019599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]