SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019699 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019699
Domain Number 1 Region: 274-560
Classification Level Classification E-value
Superfamily Kelch motif 3.27e-59
Family Kelch motif 0.0001
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily POZ domain 7.85e-26
Family BTB/POZ domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019699   Gene: ENSMMUG00000015029   Transcript: ENSMMUT00000021069
Sequence length 597
Comment pep:known chromosome:MMUL_1:20:79453695:79518700:1 gene:ENSMMUG00000015029 transcript:ENSMMUT00000021069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGSAVSDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIRTKLN
YNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLLLLTDLKTL
CCEFLEGCIAAENCIGIRDFALHYCLHHVHYLATEYLETHFRDVSSTEEFLELSPQKLKE
VISLEKLNVGNERYVFEAVIRWIAHDTEIRKVHMKDVMSALWVSGLDSSYLREQMLNEPL
VREIVKECSNIPLSQPQQGEAMLANFKPRGYSECIVTVGGEERVSRKPTAAMRCMCPLYD
PNRQLWIELAPLSMPRINHGVLSAEGFLFVFGGQDENKQTLSSGEKYDPDANTWTALPPM
NEARHNFGIVEIDGMLYILGGEDGEKELISMECYDIYSKTWTKQPDLTMVRKIGCYAAMK
KKIYAMGGGSYGKLFESVECYDPRTQQWTAICPLKERRFGAVACGVAMELYVFGGVRSRE
DAQGSEMVTCKSEFYHDEFKRWIYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTN
YDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP
Download sequence
Identical sequences A0A0D9S122 A0A0S2Z4W2 A0A2J8T9W7 A0A2K5IB94 A0A2K5MS02 A0A2K5WLB7 A0A2K6DU00 F6V530 K7D3Z5 Q9H2C0
ENSMMUP00000019699 ENSMMUP00000019699 gi|11545731|ref|NP_071324.1| NP_071324.1.87134 NP_071324.1.92137 XP_003820937.1.60992 XP_005592689.1.63531 XP_007992369.1.81039 XP_011755703.1.29376 XP_011797548.1.43180 XP_011943889.1.92194 XP_014982177.1.72884 ENSP00000476795 ENSP00000248272 ENSP00000476795 9544.ENSMMUP00000019699 9600.ENSPPYP00000008563 9606.ENSP00000248272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]