SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019759 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019759
Domain Number 1 Region: 1414-1532
Classification Level Classification E-value
Superfamily Bromodomain 5.63e-33
Family Bromodomain 0.0002
Further Details:      
 
Domain Number 2 Region: 1135-1203
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.97e-20
Family PHD domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019759   Gene: ENSMMUG00000015074   Transcript: ENSMMUT00000021132
Sequence length 1556
Comment pep:known chromosome:MMUL_1:7:97710544:97840527:-1 gene:ENSMMUG00000015074 transcript:ENSMMUT00000021132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRP
GLTYQEALESEKKARQNLQSFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEE
TVEVIRNNGARLQCRILEVLPPSHQNGFANGHVNSVDGETIIISDSDDSETQSCSFQNGK
KKDAIDPLLFKYKVQPTKKELYESAIVKATQISRRKHLFSRDKLKLFLKQHCEPQDGIIK
IKASSLSTYKIAEQDFSYFFPDDPPTFIFSPANRRRGRPPKRIPISQEDNVANKQTLASY
RNKATKERDKLLKQEEMKSLAFEKAKLKREKADALEAKKKEKEDKEKKREELKKIVEEER
LKKKEEKERLKVEREKTSKFREDYICYSEPRSCHCTPAWVTEQDSVSKKKKKKKKNKNVV
LFIFRDFSGYSQFLNAFGELFDLQDEFPDGVTLGNLLEEALVGNDSEGPLCELLFFFLTA
IFQAIAEEEEEVAKEQLTDADTKDLTEALDEDADPTKSALSAVASLAAAWPQLHQGCSLK
SLDLDSCTLSEILRLHILASGADVTSANAKYRYQKRGGFDATDDACMELRLSNPSLVKKL
SSTSVYDLTPGEKMKILHALCGKLLTLVSTRDFIEDYVDILRQAKQEFRELKAEQHRKER
EEAAARIRKRKEEKLKEQEQKLKEKQEKLKEDEQRNSTADTSIGEEEREDFDTSTESKDT
EQKELDQDMVTEDEDDPGSHKRGRRGKRGQNGFKEFTRQEEINCVTREPLTAEEDEALKQ
EHQRKEKELLEKIQSAIACTNIFPLGRDRMYRRYWIFPSIPGLFIEEDYSGLIEDMLLPR
PSSFQNNVQSQDPQVSTKTGEPLMSESTSNIEQGPRDHSVQLPKPVHKPNRWCFYSSCEQ
LDQLIEALNSRGHRESALKETLLQEKSRICAQLARFSEEKFHFSDKPQPDSKPTYSRGRS
SNAYDPSQMCAEKQLELRLRDFLLDIEDRIYQGTLGAIKVTDRYIWRSALESGRYELLSE
ENKENGIIKTVNEDVEEMEIDEQTKVIVKDRLLGIKTETPSTVSTNASTPQSVSSVVHYL
AMALFQIEQGIERRFLKAPLDASDSGRSYKTILDRWRESLLSSASLSQVFLHLSTLDRSV
IWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRPKQR
PRRLSSRQRPSLESDEDVEDSMGGEDDEVDGDEEEGQSEEEEYEVEQDEDDSQEEEEVSL
PKRGRPQVRLPVKTRGKLSSSFSSRGQRQEPGRYPSRSQQSTPKTTVSSKTGRSLRKISS
APPTETKSLRIASRSTRHSHGPLQADVFVELLSPRRKRRGRKSANNTPENSPNFPNFRVI
ATKSSEQSRSLNVASKLSLQESESTRRCRKRQSPESSPVTLGRRSSGRQGGVHELSAFEQ
LVVELVRHDDSWPFLKLVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKIASEFIDDIEL
MFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHITPSNVDQVSTPPAAKKSRI
Download sequence
Identical sequences ENSMMUP00000019759 9544.ENSMMUP00000019759 ENSMMUP00000019759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]