SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019768 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019768
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000741
Family THAP domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019768   Gene: ENSMMUG00000015085   Transcript: ENSMMUT00000021142
Sequence length 257
Comment pep:known chromosome:MMUL_1:7:49521584:49533061:-1 gene:ENSMMUG00000015085 transcript:ENSMMUT00000021142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPASKGEEERDQAGRPDTGGELQAARH
SENVPDAVSCTRPRAGKQAAASQITCENEVVQTQPHADNPSNTVTSVPTHCEEGPVHKST
QISLKRPRHRSVGIQAKVKAFGKRLCNATTQTDELWSRASSLFDIYSSDSETDTDWDIKS
EQSDLSYIAVQVKEETC
Download sequence
Identical sequences F6WVA5
ENSMMUP00000019768 XP_001089200.1.72884 ENSMMUP00000019768 9544.ENSMMUP00000019768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]