SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019816 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019816
Domain Number 1 Region: 1-62,90-126
Classification Level Classification E-value
Superfamily Translational machinery components 5.4e-38
Family Ribosomal protein L18 and S11 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019816   Gene: ENSMMUG00000015119   Transcript: ENSMMUT00000021190
Sequence length 126
Comment pep:known scaffold:MMUL_1:1099214795867:595:972:1 gene:ENSMMUG00000015119 transcript:ENSMMUT00000021190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVRVTNRDIICQIAYTRIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLL
NRFGMDKTYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGG
LSIPHS
Download sequence
Identical sequences 9544.ENSMMUP00000019816 ENSMMUP00000019816 ENSMMUP00000019816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]